General Information

  • ID:  hor006984
  • Uniprot ID:  P23259
  • Protein name:  C-type natriuretic peptide prohormone
  • Gene name:  cgba
  • Organism:  Scyliorhinus canicula
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  CNP-115 is differentially processed to produce CNP-38 and CNP-39 in the heart and CNP-22 in the brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Chondrichthyes; Elasmobranchii (elasmobranchs); Selachii (sharks); Galeomorphii; Galeoidea; Carcharhiniformes (ground sharks); Scyliorhinidae (cat sharks); Scyliorhinus; Scyliorhinus canicula (Small-spotted catshark) (Squalus canicula)
  • GO MF:  GO:0005576 extracellular region
  • GO BP:  GO:0005179 hormone activity
  • GO CC:  GO:0097746 blood vessel diameter maintenance; GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway

Sequence Information

  • Sequence:  PRSDDSLQTLSRLLEDEYGHYLPSDELNNEAEEMSPAASLPELNADQSDLELPWERESREIGGRPFRQEAVLARLLKDLSNNPLRFRGRSKKGPSRGCFGVKLDRIGAMSGLGC
  • Length:  114
  • Propeptide:  RPRSDDSLQTLSRLLEDEYGHYLPSDELNNEAEEMSPAASLPELNADQSDLELPWERESREIGGRPFRQEAVLARLLKDLSNNPLRFRGRSKKGPSRGCFGVKLDRIGAMSGLGC
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA